CECROPIN A
|
- $115 - $2159
- Product name: CECROPIN A
- CAS: 80451-04-3
- MF: C184H313N53O46
- MW: 4003.78152
- EINECS:
- MDL Number:MFCD00130752
- Synonyms:LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;CECROPIN A;CECROPIN A, PORCINE;H-LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2;Cecropin A?/Cecropin A, porcine
15 prices
Selected condition：
Brand
- AK Scientific
- Alfa Aesar
- Biorbyt Ltd
- Biosynth Carbosynth
- Sigma-Aldrich
- TRC
- Usbiological
Package
- 0.1mg
- 100μg
- 500ug
- 0.5mg
- 1mg
- 2mg
- 5mg
- 10mg
- ManufacturerAK Scientific
- Product numberG883
- Product descriptionCecropin A
- Packaging1mg
- Price$270
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66546
- Product descriptionCecropin A, porcine
- Packaging0.5mg
- Price$265
- Updated2023-06-20
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66546
- Product descriptionCecropin A, porcine
- Packaging1mg
- Price$413
- Updated2023-06-20
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364493
- Product descriptionCecropin A > 95%
- Packaging10mg
- Price$2159
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364493
- Product descriptionCecropin A > 95%
- Packaging5mg
- Price$1443.3
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364493
- Product descriptionCecropin A > 95%
- Packaging1mg
- Price$678.3
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108878
- Product descriptionCecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
- Packaging500ug
- Price$115
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108878
- Product descriptionCecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
- Packaging1mg
- Price$203
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108878
- Product descriptionCecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
- Packaging2mg
- Price$345
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108878
- Product descriptionCecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
- Packaging5mg
- Price$690
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108878
- Product descriptionCecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
- Packaging10mg
- Price$1200
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberC6830
- Product descriptionCecropin A ≥97% (HPLC), powder
- Packaging0.5mg
- Price$874
- Updated2024-03-01
- Buy
- ManufacturerSigma-Aldrich
- Product numberC6830
- Product descriptionCecropin A ≥97% (HPLC), powder
- Packaging0.1mg
- Price$230
- Updated2024-03-01
- Buy
- ManufacturerTRC
- Product numberC364858
- Product descriptionCecropin A
- Packaging100μg
- Price$125
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC2592A
- Product descriptionCecropin A
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| AK Scientific | G883 | Cecropin A | 1mg | $270 | 2021-12-16 | Buy |
| Alfa Aesar | J66546 | Cecropin A, porcine | 0.5mg | $265 | 2023-06-20 | Buy |
| Alfa Aesar | J66546 | Cecropin A, porcine | 1mg | $413 | 2023-06-20 | Buy |
| Biorbyt Ltd | orb364493 | Cecropin A > 95% | 10mg | $2159 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb364493 | Cecropin A > 95% | 5mg | $1443.3 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb364493 | Cecropin A > 95% | 1mg | $678.3 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108878 | Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 | 500ug | $115 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108878 | Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 | 1mg | $203 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108878 | Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 | 2mg | $345 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108878 | Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 | 5mg | $690 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108878 | Cecropin A H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 | 10mg | $1200 | 2021-12-16 | Buy |
| Sigma-Aldrich | C6830 | Cecropin A ≥97% (HPLC), powder | 0.5mg | $874 | 2024-03-01 | Buy |
| Sigma-Aldrich | C6830 | Cecropin A ≥97% (HPLC), powder | 0.1mg | $230 | 2024-03-01 | Buy |
| TRC | C364858 | Cecropin A | 100μg | $125 | 2021-12-16 | Buy |
| Usbiological | C2592A | Cecropin A | 1mg | $531 | 2021-12-16 | Buy |
Properties
storage temp. :-20°C
form :powder
color :White to off-white
Water Solubility :Water : ≥ 50 mg/mL (12.14 mM)
Sequence :H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
form :powder
color :White to off-white
Water Solubility :Water : ≥ 50 mg/mL (12.14 mM)
Sequence :H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Cecropin A has been used as an antimicrobial peptide (AMP):- to test its cytotoxic effect on breast adenocarcinoma (MDA-MB-231) and human mesothelioma (M14K) cell lines
- in ultrasensitive radial diffusion assay against E coli to test Galleria mellonella protein 24 and apolipophorin III effects
- to test its minimal inhibitory concentrations (MICs) in sensitivity assay for Photorhabdus variants
Related product price
- CECROPIN B
$63-1478.25 - Cupric acetylacetonate
$6-826 - N-BUTYLISOCYANIDE
$45-1028.41
Suppliers and manufacturers
Shanghai Daken Advanced Materials Co.,Ltd
Shenzhen Nexconn Pharmatechs Ltd
Hubei xin bonus chemical co. LTD
Career Henan Chemica Co
Dideu Industries Group Limited
BOC Sciences
Zhejiang J&C Biological Technology Co.,Limited
Hangzhou Go Top Peptide Biotech
