Product Categories
| Country: | China |
|---|---|
| Tel: | 21-61263452 |
| Mobile: | 13641803416 |
| E-mail: | |
| QQ: | |
| Skype: | Chat Now! |
| Company Name: | Shanghai GL Peptide Ltd |
| Tel: | 86-21-61263385 |
| Fax: | 86-21-61263399 |
| Email: | ymbetter@glbiochem |
| WebSite: | http://www.glbiochem.com |
| Nationality: | CHINA |
| Product Name | MF | CAS | Details |
|---|
| Peptide 6A | C23H43N9O6 | 73549-32-3 | Details |
| Pentagastrin 50 μg/vial (Clinalfa basic) | Details |
| Proinsulin (31-65), human, Tyr- | Details |
| Prolactin Releasing Peptides and Related Peptides | Details |
| Pep1-AGL | C40H69N11O14S | Details |
| Prepro-ANF: 104-116, human | C61H113N21O20 | Details |
| Prepro-Neuromedin S (70-103) (human) | 894454-10-5 | Details |
| Prodynorphin: 228-256 | Details |
| Protease Substrates | Details |
| Polistes Mastoparan | C77H127N21O18 | 74129-19-4 | Details |
| Pro-Adrenomedullin (12-20) human;KWNKWALSR-NH2 | C56H86N18O11 | 186027-43-0 | Details |
| pp60C-SRC Carboxy-Terminal Phosphoregulatory Peptide, Phosphorylated;TSTEPQ-pY-QPGENL | C62H95N16O28P | 149299-77-4 | Details |
| Prion Protein (118-135) (human) | C68H112N18O22S2 | 202121-03-7 | Details |
| Prion Protein (106 - 126) | Details |
| Prepro-CNP: 1-27, rat | C87H153N33O29 | Details |
| PLP 41-58 | Details |
| Preptin (rat) | 315197-73-0 | Details |
| Prosaptide TX14(A) | C69H110N16O26 | 196391-82-9 | Details |
| PrP (106-126);KTNMKHMAGAAAAGAVVGGLG | C80H138N26O24S2 | 148439-49-0 | Details |
| Pep2m | C49H92N18O13S | 243843-42-7 | Details |
| Pep4c | C48H91N17O13S | 243843-43-8 | Details |
| Procollagen Type I (212-216) | C23H45N7O9 | 149128-48-3 | Details |
| Pro-Adrenomedullin: 153-185, human | Details |
| Prepro-Atrial Natriuretic Factor (104-123) (human) | C94H171N31O28 | 112160-83-5 | Details |
| Presenilin-1 (331-349)-Cys (human, mouse) | C92H130N28O37S | 317335-35-6 | Details |
| Prepro-Nerve Growth Factor (99-115) (mouse) | C89H139N27O26 | Details |
| Peptide 810 | C59H91N13O17S | 156371-22-1 | Details |
| PLM derived peptide??;IRRLSTRRR-OH | Details |
| Prolactin Releasing Peptide (1-31), HumanPrRP-31 | Details |
| Propionyl-Amyloid β-Protein (31-34) amide | Details |
| Peptide M | C81H141N21O31 | 110652-62-5 | Details |
| TRH-Potentiating Peptide | C54H75N11O18S | Details |
| PB1(703-711), Influenza??;SSYRRPVGI | Details |
| proFIX18??;TVFLDHENANKILNRPKR | Details |
| Prolactin Releasing Peptide-31 (24-31), bovine: PrRP- | Details |
| PDGF Antagonist | C77H122N20O17 | 143784-00-3 | Details |
| Peptide 46 | C100H174N40O31 | 192122-40-0 | Details |
| Peptide B, bovine | C163H239N39O53S2 | Details |
| PKC (530-558);LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2 | C148H221N35O50S2 | 122613-29-0 | Details |
| Preangiotensinogen (11-14) (human) | Details |
| pro-ε-Tx1X/12??;LKRTIRTRLNIR | Details |
| Prosaptide, wild type | Details |
| Preprogalanin 28-67, rat | Details |
| Prepro VIP: 81-122, human | Details |
| PEP1;SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2 | C177H259N43O49S | Details |
| Platelet-Derived Growth Factor Receptor Substrate 2;SVL-pY-TAVQPNE | C54H86N13O22P | Details |
| pTH (1-44) (human) | C225H366N68O61S2 | 85568-24-7 | Details |
| Polylysine | C6H14N2O2 | 25104-18-1 | Details |
| Parathyroid Hormone (PTH) and Related Peptides | Details |
| PLP 184-199 | Details |
| Prolactin Releasing Peptide-20 (PrRP-20), bovine | Details |
| proPT18??;HVFLAPQQARSLLQRVRR | Details |
| Prolactin Releasing Peptide (1-31), rat;SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 | C28H24N4O5 | 215510-06-8 | Details |
| Peptide 74 | C62H107N23O20S2 | Details |
| Prolactin Releasing Peptide (1-31), human;SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 | C104H158N32O26 | 235433-36-0 | Details |
| Pneumadin (rat) | C47H74N12O15 | 130918-90-0 | Details |
| Pro-Cortistatin (51-81) | Details |
| Prion Protein (106-126) (human) (scrambled) | C80H138N26O24S2 | 150469-23-1 | Details |
| PKI Inhibitor (6-22), amide;TYADFIASGRTGRRNAI-NH2 | C80H130N28O24 | 121932-06-7 | Details |
| PDGF β-Receptor (719-723) (phosphorylated) | Details |
| proFIX28??;TVFLDHENANKILNRPKRYNSGKLEEFV | Details |
| Prolactin Releasing Peptide-31 (PrRP-31), bovine | Details |
| Pre-S2 (1-26) | C131H199N39O37S | 104753-45-9 | Details |
| Protein G B1 Domain (41-56) | C83H118N18O31 | 160291-75-8 | Details |
| Prolactin Releasing Peptide (12-31), rat;TPDINPAWYTGRGIRPVGRF-NH2 | C104H158N32O26 | 222988-10-5 | Details |
| Pep2-SVKI | C60H93N13O18 | 328944-75-8 | Details |
| Prepro-adrenomedullin (153-185), human;SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL | Details |
| Procollagen α1 (1187-1218) (human) | Details |
| Protease - Activated Receptor2 | Details |
| Platelet-Derived Growth Factor ?-Receptor (739-746);pY-MAPYDNY | C48H62N9O18PS | Details |
| Pro-Cortistatin (28-47) | C79H129N23O33 | Details |
| Pep2-SVKE | C59H89N13O20 | 1315378-76-7 | Details |
| Prepro-TRH (178-199) | C116H176N28O39S | 122018-92-2 | Details |
| Pep2-EVKI | C62H95N13O19 | 1315378-67-6 | Details |
| Polyphemusin II-Derived Peptide | C90H141N33O18S2 | 229030-20-0 | Details |
| Procathepsin B (26-50) (rat) | C123H198N34O33S | 317331-27-4 | Details |
| Pedibin Precursor (hydra) | C228H369N61O86S | Details |
| PLP 190-209 | Details |
| Prepro-Neuromedin U (104-136) (human) | Details |
| proPT28??;HVFLAPQQARSLLQRVRRANTFLEEVRK | Details |
| Pep2-AVKI | C60H93N13O17 | 1315378-69-8 | Details |
| Pep 4AK;KKKGSVVIVGRIILSGR-NH2 | C81H153N27O19 | Details |
| Parathyroid Hormone (1-34), bovine;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF | C183H288N54O50S2 | 12583-68-5 | Details |
| Peptide F (22-34) (bovine, ovine) | C61H95N17O17S | 88878-74-4 | Details |
| Prepro VIP/PHM: 156-170 | C71H106N16O31 | 107902-86-3 | Details |
| pTH (28-48) (human) | C95H150N28O29 | 83286-22-0 | Details |
| Prolactin Releasing Peptide (12-31), bovine;TPDINPAWYAGRGIRPVGRF-NH2 | C103H156N32O25 | Details |
| Prepro TRH (53-74) | C118H182N32O32 | Details |
| pTH (1-38) (human) | 104218-12-4 | Details |
| Procathepsin B (36-50) (rat) | C71H123N19O18S | 317331-26-3 | Details |
| Prolactin Releasing Peptide (1-31), bovine;SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 | Details |
| Pre-S1 (12-32) | C104H154N26O31S | Details |
| Pol-RFamide | C36H57N11O8 | 119116-89-1 | Details |
| Peptide F, bovine | C172H259N41O53S3 | Details |
| Pep1-TGL | C41H71N11O15S | Details |
| Prepro Corticotropin Releasing Factor (125-151), human | C115H188N40O42 | Details |
| Proadrenomedullin N-terminal 20 Peptide (Human, 9-20) | C77H119N25O14 | Details |
| Prepro VIP/PHM: 111-122 | C53H87N13O21 | Details |
| Pompilidotoxin, ?- | C71H124N22O17 | 216064-36-7 | Details |
| Preproenkephalin B (186-204), human | C78H115N21O36S | Details |
| Product Total： Product Page： | ||||
| 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 | ||||