CJC-1295 NO DAC
Price | $10 |
Package | 1GK |
Min. Order: | 1GK |
Supply Ability: | 20 tons |
Update Time: | 2021-09-07 |
Product Details
Product Name: CJC-1295 NO DAC | CAS No.: 863288-34-0 |
Min. Order: 1GK | Purity: 99% |
Supply Ability: 20 tons | Release date: 2021/09/07 |
CJC1295 Basic information |
Product Name: | CJC1295 |
Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;L-Tyrosyl-D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl |
CAS: | 863288-34-0 |
MF: | C152H252N44O42 |
MW: | 3367.89688 |
EINECS: | |
Product Categories: | Peptides |
Mol File: | 863288-34-0.mol |
CJC1295 Chemical Properties |
density | 1.45 |
About Us:
Hebei Zhanyao Biotechnology Co. LTD is established in 2010, which is a fast growing intermediate company located in Shijiazhuang, Hebei Province. After ten years of development, Hebei Zhanyao has become a diversified company, not only involved in Pharmaceutical Intermediates, but also in the field of agricultural products. Also Have factory for plastic&rubbler granule, So far, Hebei Zhanyao has operations in 35 countries, and most of its big customers are from Europe and the United States. The quality of hebei Zhanyao products is always the best among Chinese suppliers, with some products of 99.9+ purity. This is an important reason for customers to choose
High quality with competitive price.
1. Standard bp/usp/ep/enterprise standard.
2. All purity>99%.
3. We are manufacturer and can provide high quality products with factory price.
Fast and safe delivery.
1. Parcel can be sent out in 24 hours after payment tracking number available.
2. Secure and discreet shipment verious transportation methods for your choice.
3. Customs pass rate >99%.
4. We have our own agent/remailer/distributor who can help us ship our products very fast and safe, and we have stock in there for transferring.
We have clients throughout the world.
1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their desire.
2. Market feedback and goods feedback will be appreciated , meeting customers' requirement is our responsibility.
3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from the customers.
Company Profile Introduction
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$49.00/1Box |
VIP1Y
|
American HealthyMorph LLC
|
2025-01-02 | |
$5.00/1box |
VIP1Y
|
Hebei Jiafan Trading Company Limited
|
2024-12-23 | |
$70.00/1box |
VIP6Y
|
Shanghai Longyu Biotechnology Co., Ltd.
|
2024-11-23 | |
$5.00/1BOX |
VIP1Y
|
Hefei zhanzhanda trading Co., LTD
|
2024-10-29 | |
$0.00/10box |
VIP2Y
|
Shandong Hanjiang Chemical Co., Ltd
|
2024-10-12 | |
$20.00/1kg |
VIP1Y
|
Shaanxi Franta Biotechnology Co., Ltd
|
2024-09-23 | |
$45.00/1Box |
VIP1Y
|
Qingdao Xinli Technology Development Co., Ltd.
|
2024-07-25 | |
$5.00/5mg |
VIP1Y
|
Hebei Ganmiao New material Technology Co., LTD
|
2024-06-27 | |
$0.10/20mg |
VIP1Y
|
Shanghai Likang New Materials Co., Limited
|
2024-05-28 | |
$85.00/1box |
VIP1Y
|
Strong peptide cross-border e-commerce Co. LTD
|
2024-05-23 |
- Since: 2015-10-08
- Address: Room 1103-1,Haiyue Building,YuHuaXi Road, Qiaoxi District , Shijiazhuang, Hebei province