APELIN-36 (HUMAN)
- $123 - $1583
- Product name: APELIN-36 (HUMAN)
- CAS: 252642-12-9
- MF: C184H295N69O42R2S
- MW: 4177.8132
- EINECS:
- MDL Number:MFCD01865608
- Synonyms:M.W. 4195.83 C184H297N69O43S;L-Leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginylglycyl-L-seryl-L-arginyl-L-asparaginylglycyl-L-prolylglycyl-L-prolyl-L-tryptophyl-L-glutaminylglycylglycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine;Apelin (human);LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE;APELIN-36 (HUMAN);Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
12 prices
Selected condition:
Brand
- Alfa Aesar
- ApexBio Technology
- Biosynth Carbosynth
- Cayman Chemical
- Tocris
Package
- 100ug
- 250ug
- 500ug
- 500μg
- 1
- 1mg
- 2mg
- 5mg
- ManufacturerAlfa Aesar
- Product numberJ66238
- Product descriptionApelin-36, human
- Packaging1mg
- Price$238
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66238
- Product descriptionApelin-36, human
- Packaging5mg
- Price$542
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5303
- Product descriptionApelin-36, human
- Packaging1mg
- Price$692
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA109395
- Product descriptionApelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
- Packaging100ug
- Price$123
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA109395
- Product descriptionApelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
- Packaging250ug
- Price$245
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA109395
- Product descriptionApelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
- Packaging500ug
- Price$425
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA109395
- Product descriptionApelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
- Packaging1mg
- Price$742
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFA109395
- Product descriptionApelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
- Packaging2mg
- Price$1290.44
- Updated2021-12-16
- Buy
- ManufacturerCayman Chemical
- Product number13524
- Product descriptionApelin-36 ≥95%
- Packaging5mg
- Price$1583
- Updated2024-03-01
- Buy
- ManufacturerCayman Chemical
- Product number13524
- Product descriptionApelin-36 ≥95%
- Packaging1mg
- Price$378
- Updated2024-03-01
- Buy
- ManufacturerCayman Chemical
- Product number13524
- Product descriptionApelin-36 ≥95%
- Packaging500μg
- Price$199
- Updated2024-03-01
- Buy
- ManufacturerTocris
- Product number2426
- Product descriptionApelin-36, human
- Packaging1
- Price$480
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
Alfa Aesar | J66238 | Apelin-36, human | 1mg | $238 | 2021-12-16 | Buy |
Alfa Aesar | J66238 | Apelin-36, human | 5mg | $542 | 2021-12-16 | Buy |
ApexBio Technology | B5303 | Apelin-36, human | 1mg | $692 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA109395 | Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH | 100ug | $123 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA109395 | Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH | 250ug | $245 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA109395 | Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH | 500ug | $425 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA109395 | Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH | 1mg | $742 | 2021-12-16 | Buy |
Biosynth Carbosynth | FA109395 | Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH | 2mg | $1290.44 | 2021-12-16 | Buy |
Cayman Chemical | 13524 | Apelin-36 ≥95% | 5mg | $1583 | 2024-03-01 | Buy |
Cayman Chemical | 13524 | Apelin-36 ≥95% | 1mg | $378 | 2024-03-01 | Buy |
Cayman Chemical | 13524 | Apelin-36 ≥95% | 500μg | $199 | 2024-03-01 | Buy |
Tocris | 2426 | Apelin-36, human | 1 | $480 | 2021-12-16 | Buy |
Properties
storage temp. :-15°C
solubility :DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml
form :Lyophilized powder
color :White to off-white
Water Solubility :Soluble in water at 1mg/ml
solubility :DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml
form :Lyophilized powder
color :White to off-white
Water Solubility :Soluble in water at 1mg/ml
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
The apelin gene encodes a preproprotein that is processed to generate a variety of bioactive peptides, including those having 36, 17, or 13 amino acids (apelin-36, apelin-17, and apelin-13, respectively). The apelin proteins are the endogenous ligands of the G protein-coupled receptor, APJ. Apelin-36 is the full-length mature peptide produced from the translated 77 amino acid prepropeptide. The apelins act primarily in the peripheral and central nervous system, playing important roles in regulating cardiovascular function, fluid homeostasis, hypertension, and insulin sensitivity. Apelin-36 is a less potent agonist of APJ than either apelin-17 or apelin-13 (EC50 = 20, 2.5, and 0.37 nM, respectively). Apelin-36 potently inhibits HIV-1 entry into cells expressing APJ and CD4, limiting HIV infection.Related product price
- spinorphin
$53.58-535 - GALANIN, HUMAN
$140-1733 - Ferric acetylacetonate
$6-2359.48
Suppliers and manufacturers
Shenzhen Nexconn Pharmatechs Ltd
Cellmano Biotech Limited
Hangzhou Go Top Peptide Biotech
Chengdu Youngshe Chemical Co., Ltd.
Nanjing TGpeptide
Aladdin Scientific
Changsha MOL Changes Biotechnology Co., Ltd.
3B Pharmachem (Wuhan) International Co.,Ltd.
GL Biochem (Shanghai) Ltd