天堂网亚洲,天天操天天搞,91视频高清,菠萝蜜视频在线观看入口,美女视频性感美女视频,95丝袜美女视频国产,超高清美女视频图片

ChemicalBook--->CAS DataBase List--->209615-79-2

209615-79-2

209615-79-2 Structure

209615-79-2 Structure
IdentificationBack Directory
[Name]

CART (55-102) (RAT)
[CAS]

209615-79-2
[Synonyms]

CART (55-102)
CART (RAT, 55-102)
CART (55-102) (RAT)
CART, MOUSE/RAT, (55-102)
CARP, MOUSE/RAT, (55-102)
CART Fragment 55-102 rat
CART Fragment 55-102 human
CART PEPTIDE (AA 55-102), RAT
COCAINE- AND AMPHETAMINE-REGULATED TRANSCRIPT
COCAINE-AND AMPHETAMINE-REGULATED TRANSCRIPT (55-102) (RAT)
COCAINE- AND AMPHETAMINE-REGULATED TRANSCRIPT (RAT, 55-102)
COCAINE- AND AMPHETAMINE RELATED TRANSCRIPT, MOUSE/RAT, (55-102)
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (DISULFIDE BRIDGE: 74-94,68-86 AND 88-101)
ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU
H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYA-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHELEU-LEU-LYS-CYS-LEU-OH
H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU-OH
H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU-OH (DISULFIDE BRIDGE: 74-94, 68-86, AND 88-101)
ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCDISULFIDE BRIDG
CART (55-102) (rat) H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101)
L-Leucine,L-isoleucyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-α-glutamyl-L-lysyl-L-lysyl-L-tyrosylglycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-α-aspartyl-L-alanylglycyl-L-α-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysylglycyl-L-alanyl-L-arginyl-L-isoleucylglycyl-L-lysyl-L-leucyl-L-cysteinyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-arginylglycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-,cyclic(14→32),(20→40),(34→47)-tris(disulfide)
L-Isoleucyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-lysyl-L-tyrosylglycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanylglycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysylglycyl-L-alanyl-L-arginyl-L-isoleucylglycyl-L-lysyl-L-leucyl-L-cysteinyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-arginylglycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-L-leucine cyclic (14-32),(20-40),(34-47)-tris(disulfide)
[Molecular Formula]

C226H367N65O65S7
[MDL Number]

MFCD01865992
[MOL File]

209615-79-2.mol
[Molecular Weight]

5259.18
Questions And AnswerBack Directory
[Structure]

CART peptides of different lengths have been found in various tissues. The rat central nervous system contains CART55–102 and CART62–102 fragments. In the periphery, longer products are generated in addition to CART55–102. Adrenal glands in the rat produce two peptides, CART1–89 and CART10–89. The most widely studied peptides are CART55–102 and CART62–102 . Both peptides contain a cysteine-knot motif, which is critical for the biological activity of the hormone. The human CART42–89 corresponds to the rodent CART55–102. Genome studies have revealed that fish have multiple CART genes. Two different goldfish CART55–102 (Goldfish I and II) genes present high homology with their mammalian counterparts in their C-terminal end region.
	CART (55-102) (RAT)
[Gene, mRNA, and precursor]

The human CART gene, CARTPT, located in the 5q13.2 region, consists of two introns and three exons. Due to alternative splicing, the rodent CART mRNA produces two spliced variants of proCART. Long and short forms encode a 102 aa sequence or an 89 aa sequence, respectively. Only the latter has been found in humans.
[Synthesis and release]

In hypothalamic explants, the neuropeptide Y (NPY) significantly increased the release of CART (55–102) immunoreactivity. In vivo experiments showed that leptin administration induces Fos expression in hypothalamic CART neurons. NPY and CART are coexpressed in the same neurons in the dorsomedial hypothalamus in chronic obesity. These neurons are activated by peripheral leptin treatment in diet-induced obesity. Thus, CART peptides are anorexigenic and closely associated with leptin and NPY, two important food intake regulators. CART is also released in response to repeated dopamine release in the nucleus accumbens.
[Biological functions]

In the goldfish, the central administration of human CART has been shown to decrease food intake. In mammals, CART modulates various physiological processes such as feeding, energy expenditure, stress control, and endocrine secretion.
[Receptors]

Although CART-responsive cell lines or neurons were reported, the receptor for CART has not been clarified yet. It is speculated that CART55–102 and CART62–102 do not share the same receptor, as they show different physiological activities in vivo. In 2020, CART55-102 was suggested to be a ligand of an orphan GPCR, GPR160, from biological assays. Further pharmacology would be required on GPR160 and CART for confirmation. The signal transduction pathway is predicted to be mainly coupled to the Gi/o protein and to stimulate ERK1/2 activation or inhibit calcium signaling.
[Clinical implications]

In an obese 10-year-old boy, where the onset of obesity was at the age of 2, a G-to-C transversion at nucleotide 729 of the CART gene was identified, resulting in missense mutation, a leucine to phenylalanine substitution at codon 34 (L34F). This mutation affects posttranslational processing and causes bioactive CART deficiency in the serum. The L34F mutation segregated with severe obesity over three generations in this family, and was not identified in the control population. The affected subjects demonstrated reduced resting energy expenditures. Further, sequence variability in the CART gene has been identified as being related to obesity in several hundred French subjects.
Chemical PropertiesBack Directory
[storage temp. ]

-15°C
[form ]

Solid
[color ]

White to off-white
[Water Solubility ]

Soluble to 1 mg/ml in Water
Hazard InformationBack Directory
[Uses]

CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior[1][2].
[General Description]

CART, so named because of upregulation by cocaine and amphetamine, is thought to be involved in the regulation of feeding and stress. However, its cognate receptor has not yet been identified. In the 1980s, a fragment of the CART peptide was identified in an extract of ovine hypothalamus. Fifteen years later, the level of CART mRNA was found to increase in the rat striatum after acute administration of cocaine and amphetamine. Subsequently, in 1999, CART peptides were extracted and sequenced from the rat, and it was found that two different forms (CART55–102 and CART62–102) were present.
[storage]

Store at -20°C
[References]

[1] H Volkoff, et al. Effects of CART Peptides on Food Consumption, Feeding and Associated Behaviors in the Goldfish, Carassius Auratus: Actions on Neuropeptide Y- And Orexin A-induced Feeding. Brain Res. 2000 Dec 22;887(1):125-33. DOI:10.1016/s0006-8993(00)03001-8
[2] Shigeyuki Chaki, et al. Cocaine- And Amphetamine-Regulated Transcript Peptide Produces Anxiety-Like Behavior in Rodents. Eur J Pharmacol. 2003 Mar 7;464(1):49-54. DOI:10.1016/s0014-2999(03)01368-2
209615-79-2 suppliers list
Company Name: career henan chemical co
Tel: +86-0371-86658258 +8613203830695 , +8613203830695
Website: www.coreychem.com
Company Name: Chengdu Youngshe Chemical Co., Ltd.
Tel: +8618108235634 , +8618108235634
Website: http://www.youngshechem.com/
Company Name: Nanjing TGpeptide
Tel: +86-13347807150 +86-13347807150 , +86-13347807150
Website: tgpeptides.com/index.aspx
Company Name: Aladdin Scientific
Tel:
Website: www.aladdinsci.com/
Company Name: Changsha MOL Changes Biotechnology Co., Ltd.
Tel: +8619375158599 , +8619375158599
Website: www.molchanges.com
Company Name:   
Tel: 821-50328103-801 18930552037
Website: http://www.approvedhomemanagement.com/ShowSupplierProductsList13285/0.htm
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Website: http://www.glschina.com/
Company Name: Shanghai Hanhong Scientific Co.,Ltd.  
Tel: 021-54306202 13764082696
Website: https://www.hanhongsci.com
Company Name: Chemsky (shanghai) International Co.,Ltd  
Tel: 021-50135380
Website: www.shchemsky.com
Company Name: Cellmano Biotech Limited  
Tel: 0551-65326643 18156095617
Website: https://www.cellmano.com
Company Name: Hangzhou Sage Chemical Co., Ltd.  
Tel: +86057186818502 13588463833
Website: www.sagechem.com
Company Name: Wuxi Zhongkun Biochemical Technology Co., Ltd.  
Tel: 0510-85629785 18013409632
Website: www.reading-chemicals.com
Company Name: Nanjing Leon Biological Technology Co., Ltd.  
Tel: 17705183659
Website: www.njleonbiotech.com
Company Name: Nanjing Peptide Biotech Ltd.  
Tel: 025-025-58361106-805-805 13082558573
Website: http://www.njpeptide.com
Company Name: Chengdu Youngshe Chemical Co., Ltd.  
Tel: +86-17380623303 +86-17380623303
Website: https://shop326109856.taobao.com/
Company Name: Hangzhou Peptidego Biotech Co.,Ltd.  
Tel: 0571-87213919
Website: http://www.peptidego.com
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.  
Tel: meitaochem@126.com
Website: www.approvedhomemanagement.com/ShowSupplierProductsList31244/0.htm
Company Name: BOC Sciences  
Tel:
Website: https://www.bocsci.com
Tags:209615-79-2 Related Product Information
50-36-2 36635-61-7 39687-95-1 7188-38-7 645-96-5 14542-93-9 2769-64-4 2999-46-4

  • HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.